| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-9-b-32-c-13 | 10-b-37 |
Chain Sequence |
AMDCTTGPCCRQCKLKPAGTTCWKTSVSSHYCTGRSCECPSYPGNG
|
| sequence length |
46
|
| structure length |
46
|
| publication title |
NMR Structure and Dynamics of Recombinant Wild-Type and Mutated Jerdostatin, a Selective Inhibitor of Integrin Alpha1 Beta1
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
SHORT DISINTEGRIN JERDOSTATIN
|
| source organism |
Trimeresurus jerdonii
|
| ec nomenclature | |
| pdb deposition date | 2009-01-29 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Echistatin | Echistatin |
#chains in the KnotProt database with same CATH superfamily 2W9O A; 2W9U A; 1MPZ A; 2W9V A; 2W9W A; #chains in the KnotProt database with same CATH topology 2W9O A; 2W9U A; 1MPZ A; 2W9V A; 2W9W A; #chains in the KnotProt database with same CATH homology 2W9O A; 2W9U A; 1MPZ A; 2W9V A; 2W9W A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...