Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 4-c-9-b-32-c-13 | 10-b-37 |
Chain Sequence |
AMDCTTGPCCRQCKLKPAGTTCWKTSVSSHYCTGRSCECPSYPG
|
sequence length |
44
|
structure length |
44
|
publication title |
NMR Structure and Dynamics of Recombinant Wild-Type and Mutated Jerdostatin, a Selective Inhibitor of Integrin Alpha1 Beta1
pubmed doi rcsb |
molecule tags |
Toxin
|
molecule keywords |
SHORT DISINTEGRIN JERDOSTATIN
|
source organism |
Trimeresurus jerdonii
|
ec nomenclature | |
pdb deposition date | 2009-01-29 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Echistatin | Echistatin |
#chains in the KnotProt database with same CATH superfamily 2W9V A; 2W9W A; 2W9U A; 2W9O A; 1MPZ A; #chains in the KnotProt database with same CATH topology 2W9V A; 2W9W A; 2W9U A; 2W9O A; 1MPZ A; #chains in the KnotProt database with same CATH homology 2W9V A; 2W9W A; 2W9U A; 2W9O A; 1MPZ A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...