| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 117-190 | 74 | 1-116 | 205-236 | 191-204 | 116 | 32 | slipknot |
Chain Sequence |
SNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALK----FSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHP
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
 |
2.1 | 20-187 | 168 | 1-3, 201-232 | 4-19, 188-200 | 3 | 32 | slipknot | ||
| view details |
|
|
2.1 | 20-200 | 181 | 1-3, 202-232 | 4-19, 201-201 | 3 | 31 | slipknot | ||
| view details |
|
|
2.1 | 30-189 | 160 | 1-21, 201-232 | 22-29, 190-200 | 21 | 32 | slipknot | ||
| view details |
 |
3.1 | 69-190 | 122 | 1-54, 198-232 | 55-68, 191-197 | 54 | 35 | slipknot | |||
| view details |
|
2.1 | 77-188 | 112 | 1-68, 198-232 | 69-76, 189-197 | 68 | 35 | slipknot | |||
| view details |
|
2.1 | 77-197 | 121 | 1-68, 200-232 | 69-76, 198-199 | 68 | 33 | slipknot | |||
| view details |
|
3.1 | 112-189 | 78 | 1-104, 201-232 | 105-111, 190-200 | 104 | 32 | slipknot |
| sequence length |
236
|
| structure length |
232
|
| publication title |
High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Colicin E7
|
| source organism |
Escherichia coli str. k12 substr.
|
| missing residues |
46-49
|
| total genus |
 Genus: 57
|
| ec nomenclature |
ec
3.1.-.-: |
| pdb deposition date | 2005-09-04 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03515 | Cloacin | Colicin-like bacteriocin tRNase domain |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
