2AXCA

Crystal structure of cole7 translocation domain
Slipknot S +31 +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 117-190 74 1-116 205-236 191-204 116 32 slipknot
Chain Sequence
SNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALK----FSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 20-187 168 1-3, 201-232 4-19, 188-200 3 32 slipknot
view details
2.1 20-200 181 1-3, 202-232 4-19, 201-201 3 31 slipknot
view details
2.1 30-189 160 1-21, 201-232 22-29, 190-200 21 32 slipknot
view details
3.1 69-190 122 1-54, 198-232 55-68, 191-197 54 35 slipknot
view details
2.1 77-188 112 1-68, 198-232 69-76, 189-197 68 35 slipknot
view details
2.1 77-197 121 1-68, 200-232 69-76, 198-199 68 33 slipknot
view details
3.1 112-189 78 1-104, 201-232 105-111, 190-200 104 32 slipknot
missing residues 46-49
publication title High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes
pubmed doi rcsb
structure length 232
molecule tags Hydrolase
source organism Escherichia coli str. k12 substr.
sequence length 236
total genus Genus: 57
molecule keywords Colicin E7
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-04
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03515 Cloacin Colicin-like bacteriocin tRNase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling