2C4BB

Inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a
Cysteine knot
Loop Piercing
view details
117-c-124-b-136-c-134 130-b-142
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIRSSSMGVCPKILKKCRRDSDCLAGCVCGPNGFCGS
sequence length 142
structure length 142
publication title Barnase Fusion as a Tool to Determine the Crystal Structure of the Small Disulfide-Rich Protein Mcoeeti.
pubmed doi rcsb
molecule tags Fusion protein
molecule keywords BARNASE MCOEETI FUSION
source organism Bacillus amyloliquefaciens
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2005-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling