
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 6-77 | 72 | 1-5, 78-82 | 5 | 5 | knot |
Chain Sequence |
FMKEKKRATFYLYKNIDGRKLRYLLHKLENVENVDIDTLRRAIEAEKKYKRSITLTEEEEVIIQRLGKSANLLLNCELVKLD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 8-79 | 72 | 1-7, 80-82 | 7 | 3 | knot | ||||
view details |
![]() |
2.1m | 8-71 | 64 | 1-7 | 80-82 | 72-79 | 7 | 3 | slipknot | ||
view details |
![]() |
1.1m | 13-71 | 59 | 72-82 | 1-7 | 8-12 | 7 | 10 | slipknot |
sequence length |
82
|
structure length |
82
|
publication title |
Crystal Structure of a Hypothetical Protein(MJ0366) from Methanocaldococcus jannaschii
rcsb |
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Hypothetical protein MJ0366
|
source organism |
Methanocaldococcus jannaschii dsm 2661
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2007-02-26 |
KnotProt deposition date | 2018-10-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10802 | DUF2540 | Protein of unknown function (DUF2540) |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...