2EFVA

Crystal structure of a hypothetical protein(mj0366) from methanocaldococcus jannaschii
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 6-77 72 1-5, 78-82 5 5 knot
Chain Sequence
FMKEKKRATFYLYKNIDGRKLRYLLHKLENVENVDIDTLRRAIEAEKKYKRSITLTEEEEVIIQRLGKSANLLLNCELVKLD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 8-71 64 1-7 81-82 72-80 7 2 slipknot
view details
2.1m 13-71 59 1-7, 81-82 8-12, 72-80 7 2 slipknot
view details
1.1m 13-80 68 1-7, 82-82 8-12, 81-81 7 1 slipknot
publication title Crystal Structure of a Hypothetical Protein(MJ0366) from Methanocaldococcus jannaschii
rcsb
structure length 82
molecule tags Structural genomics, unknown function
source organism Methanocaldococcus jannaschii dsm 2661
sequence length 82
total genus Genus: 30
molecule keywords Hypothetical protein MJ0366
ec nomenclature
pdb deposition date 2007-02-26
KnotProt deposition date 2018-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10802 DUF2540 Protein of unknown function (DUF2540)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling