2ERIA

Solution structure of circulin b
Cysteine knot
Loop Piercing
view details
1-c-5-b-19-c-17 10-b-24
Chain Sequence
CGESCVFIPCISTLLGCSCKNKVCYRNGVIP
sequence length 31
structure length 31
publication title Structure of circullin B and implications for antimicrobial activity of the cyclotides
pubmed doi rcsb
molecule tags Antibiotic
molecule keywords Circulin B
source organism Chassalia parviflora
ec nomenclature
pdb deposition date 2005-10-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.