| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-5-b-19-c-17 | 10-b-24 |
Chain Sequence |
CGESCVFIPCISTLLGCSCKNKVCYRNGVIP
|
| sequence length |
31
|
| structure length |
31
|
| publication title |
Structure of circullin B and implications for antimicrobial activity of the cyclotides
pubmed doi rcsb |
| molecule tags |
Antibiotic
|
| molecule keywords |
Circulin B
|
| source organism |
Chassalia parviflora
|
| ec nomenclature | |
| pdb deposition date | 2005-10-24 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
