| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 174-238 | 65 | 1-173, 239-320 | 173 | 82 | knot |
Chain Sequence |
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 173-240 | 68 | 1-172, 241-320 | 172 | 80 | knot | ||||
| view details |
 |
3.1 | 176-259 | 84 | 1-172, 285-320 | 173-175, 260-284 | 172 | 36 | slipknot | |||
| view details |
|
2.1 | 176-284 | 109 | 1-172, 299-320 | 173-175, 285-298 | 172 | 22 | slipknot |
| sequence length |
320
|
| structure length |
320
|
| publication title |
Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
putative ornithine carbamoyltransferase
|
| source organism |
Bacteroides fragilis
|
| total genus |
 Genus: 118
|
| ec nomenclature |
ec
2.1.3.-: ec 2.1.3.11: N-succinylornithine carbamoyltransferase. |
| pdb deposition date | 2005-12-21 |
| KnotProt deposition date | 2021-05-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF00185 | OTCace | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| C | PF02729.16 | OTCace_N | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| C | PF00185.19 | OTCace | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
