2FUUA

Nmr solution structure of the phd domain from the human bptf in complex with h3(1-15)k4me3 peptide
Cysteine knot
Loop Piercing
view details
13-c-29-b-53-c-37 11-b-37
Chain Sequence
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
sequence length 62
structure length 62
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords bromodomain PHD finger transcription factor
source organism Homo sapiens
ec nomenclature
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2fuuA00
2FUUA
chains in the KnotProt database with same CATH superfamily
2FUUA
chains in the KnotProt database with same CATH topology
2FUUA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2FUU A; 
#chains in the KnotProt database with same CATH topology
 2FUU A; 
#chains in the KnotProt database with same CATH homology
 2FUU A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.