| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-6-b-21-c-18 | 12-b-35 |
Chain Sequence |
LCNEPCSSNSDCIGITLCQFCKEKTDQYGLTYRTCNLLP
|
| sequence length |
39
|
| structure length |
39
|
| publication title |
NMR solution structure of a new tomato peptide
rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Fruit-specific protein
|
| ec nomenclature | |
| pdb deposition date | 2006-07-07 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
