2I1TA

Solution structure of jingzhaotoxin-iii, a novel toxin inhibiting both nav and kv channels
Cysteine knot
Loop Piercing
view details
4-c-11-b-24-c-19 18-b-31
Chain Sequence
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP
sequence length 36
structure length 36
publication title Solution structure of Jingzhaotoxin-III, a novel toxin inhibiting both Nav and Kv channels
rcsb
molecule tags Toxin
molecule keywords Jingzhaotoxin-3
ec nomenclature
pdb deposition date 2006-08-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling