2I9BE

Crystal structure of atf-urokinase receptor complex
Cysteine knot
Loop Piercing
view details
3-c-17-b-45-c-45 3-b-24
Chain Sequence
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCH----QSLQCRSPEEQCLDVVTHWIQRPKDD-----RHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMVRGCATASAHLGDAFSMN----HIDVSCCTKSGCNHPDLD
sequence length 278
structure length 265
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
source organism Homo sapiens
missing residues 107-110, 133-137, 247-250
ec nomenclature
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
4K24U 1YWHA 2FD6U 3BT1U 3BT2U 3U73U 4QTIU 7E17A 7V63A
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
4K24 U; 
#similar chains, but unknotted
7V63 A; 
#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.