| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-17-b-45-c-45 | 3-b-24 |
Chain Sequence |
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCH----QSLQCRSPEEQCLDVVTHWIQRPKDD-----RHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMVRGCATASAHLGDAFSMN----HIDVSCCTKSGCNHPDLD
|
| sequence length |
278
|
| structure length |
265
|
| publication title |
Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Urokinase-type plasminogen activator
|
| source organism |
Homo sapiens
|
| missing residues |
107-110, 133-137, 247-250
|
| ec nomenclature | |
| pdb deposition date | 2006-09-05 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
