2I9BF

Crystal structure of atf-urokinase receptor complex
Cysteine knot
Loop Piercing
view details
3-c-17-b-45-c-45 3-b-24
Chain Sequence
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCH----QSLQCRSPEEQCLDVVTHWIQRPKDD-----RHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMVRGCATASAHLGDAFSMN----HIDVSCCTKSGCNHPDLD
sequence length 278
structure length 265
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
source organism Homo sapiens
missing residues 107-110, 133-137, 247-250
ec nomenclature
pdb deposition date 2006-09-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.