2J6BA

Crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-77 74 1-3 103-109 78-102 3 7 slipknot
Chain Sequence
MLYILNSAILPLKPGEEYTVKAKEITIQEAKELVTKEQFTSAIGHQATAELLSSILGVNVPMNRVQIKVTHGDRILAFMLKQRLPEGVVVKTTEELEKIGYELWLFEIQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 3-83 81 1-2 88-109 84-87 2 22 slipknot
view details
3.1 3-91 89 1-2 97-109 92-96 2 13 slipknot
publication title Crystal Structure of Afv3-109, a Highly Conserved Protein from Crenarchaeal Viruses.
pubmed doi rcsb
structure length 109
molecule tags Viral protein
source organism Acidianus filamentous virus 1
sequence length 109
total genus Genus: 26
molecule keywords AFV3-109
ec nomenclature
pdb deposition date 2006-09-27
KnotProt deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling