| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 4-82 | 79 | 1-3 | 113-117 | 83-112 | 3 | 5 | slipknot |
Chain Sequence |
GKVFLTNAFSINMLKEFPTTITIDKLDEEDFCLKLELRLEDGTLINAIGHDSTINLVNTLCGTQLQKNRVEVKMNEGDEALIIMISQRLEEGKVLSDKEIKDMYRQGKISFYEVWHH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 4-86 | 83 | 1-3 | 91-117 | 87-90 | 3 | 27 | slipknot | ||
| view details |
|
3.1 | 4-90 | 87 | 1-3 | 111-117 | 91-110 | 3 | 7 | slipknot |
| sequence length |
117
|
| structure length |
117
|
| publication title |
A New DNA Binding Protein Highly Conserved in Diverse Crenarchaeal Viruses
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| molecule keywords |
STIV B116
|
| source organism |
Sulfolobus turreted icosahedral virus
|
| total genus |
 Genus: 24
|
| ec nomenclature | |
| pdb deposition date | 2006-10-19 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08960 | DUF1874 | Domain of unknown function (DUF1874) |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
