| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 47-c-69-b-73-c-73 | 42-b-69 |
Chain Sequence |
QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKS
|
| sequence length |
60
|
| structure length |
60
|
| publication title |
Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| molecule keywords |
Protein YNG1
|
| source organism |
Saccharomyces cerevisiae
|
| ec nomenclature | |
| pdb deposition date | 2006-11-15 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
