| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 24-72 | 49 | 1-23, 73-109 | 23 | 37 | knot |
Chain Sequence |
GGSSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKKKV
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 22-89 | 68 | 1-21, 90-109 | 21 | 20 | knot | ||||
| view details |
|
3.1m | 21-73 | 53 | 1-20 | 90-109 | 74-89 | 20 | 20 | slipknot |
| sequence length |
109
|
| structure length |
109
|
| publication title |
Solution structure of the U2 snRNP protein Rds3p reveals a knotted zinc-finger motif.
pubmed doi rcsb |
| molecule tags |
Metal binding protein
|
| molecule keywords |
Pre-mRNA-splicing factor RDS3
|
| source organism |
Saccharomyces cerevisiae
|
| total genus |
 Genus: 20
|
| ec nomenclature | |
| pdb deposition date | 2008-01-31 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03660 | PHF5 | PHF5-like protein |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
