2K0AA

1h, 15n and 13c chemical shift assignments for rds3 protein
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 24-72 49 1-23, 73-109 23 37 knot
Chain Sequence
GGSSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKKKV
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 22-89 68 1-21, 90-109 21 20 knot
view details
3.1m 21-73 53 1-20 90-109 74-89 20 20 slipknot
publication title Solution structure of the U2 snRNP protein Rds3p reveals a knotted zinc-finger motif.
pubmed doi rcsb
structure length 109
molecule tags Metal binding protein
source organism Saccharomyces cerevisiae
sequence length 109
total genus Genus: 20
molecule keywords Pre-mRNA-splicing factor RDS3
ec nomenclature
pdb deposition date 2008-01-31
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03660 PHF5 PHF5-like protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling