2KD3 | KnotProt

Cysteine knot

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet3 start applet null

Jmol JavaScript applet jmolApplet3__405737531903663__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet3__405737531903663__)

vwrOptions:

{ "name":"jmolApplet3","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/2kd3/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet3__405737531903663__","codePath":"https:/static/js/j2s/","display":"jmolApplet3_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"405737531903663","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/2kd3/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet3 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet3__405737531903663__ ready

script 1 started

platformSpeed = 8

Help Cysteine knot data interpretation Full screen

				Loop	Piercing
view details				55-c-69-b-123-c-109	80-b-140

Chain Sequence

KDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKR

sequence length	97
structure length	97
publication title	NMR structure of the Wnt modulator protein Sclerostin pubmed doi rcsb
molecule tags	Protein binding
molecule keywords	Sclerostin
source organism	Mus musculus
ec nomenclature
pdb deposition date	2009-01-02

Image from the rcsb pdb (www.rcsb.org)

2K8PA 6L6RC
similar chains in the KnotProt database (40% sequence similarity)

None
similar chains in the pdb database (40% sequence similarity)

#similar chains in the KnotProt database (40% sequence similarity)
2K8P A; 6L6R C; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)

2KD3A

Cysteine knot

Chain Sequence