2KNIA

High-resolution solution structure of the asic1a blocker pctx1
Cysteine knot
Loop Piercing
view details
4-c-11-b-24-c-19 18-b-34
Chain Sequence
SEDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
sequence length 41
structure length 41
publication title A dynamic pharmacophore drives the interaction between Psalmotoxin-1 and the putative drug target acid-sensing ion channel 1a.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Psalmotoxin-1
source organism Psalmopoeus cambridgei
ec nomenclature
pdb deposition date 2009-08-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling