| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-8-b-22-c-20 | 13-b-27 |
Chain Sequence |
GIPCGESCVWIPCISSAIGCSCKSKVCYRN
|
| sequence length |
30
|
| structure length |
30
|
| publication title |
The conserved glu in the cyclotide cycloviolacin O2 has a key structural role.
pubmed doi rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Cycloviolacin-O2
|
| ec nomenclature | |
| pdb deposition date | 2009-08-27 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...