2KNMA

Solution structure of the cyclotide cycloviolacin o2
Cysteine knot
Loop Piercing
view details
4-c-8-b-22-c-20 13-b-27
Chain Sequence
GIPCGESCVWIPCISSAIGCSCKSKVCYRN
sequence length 30
structure length 30
publication title The conserved glu in the cyclotide cycloviolacin O2 has a key structural role.
pubmed doi rcsb
molecule tags Plant protein
molecule keywords Cycloviolacin-O2
ec nomenclature
pdb deposition date 2009-08-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling