2KNPA

Isolation and characterization of peptides from momordica cochinchinensis seeds.
Cysteine knot

  Help Cysteine knot data interpretation Full screen
Loop Piercing
view details
2-c-7-b-19-c-17 13-b-30
Chain Sequence
GCEGKQCGLFRSCGGGCRCWPTVTPGVGICSSS
sequence length 33
structure length 33
publication title Isolation and characterization of peptides from Momordica cochinchinensis seeds.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords MCoCC-1
ec nomenclature
pdb deposition date 2009-08-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling