2KUKA

Solution structure of vhl-2
Cysteine knot
Loop Piercing
view details
1-c-5-b-17-c-15 10-b-23
Chain Sequence
CGETCFTGTCYTNGCTCDPWPVCTRNGLPV
sequence length 30
structure length 30
publication title Structure and Activity of the Leaf-Specific Cyclotide vhl-2
doi rcsb
molecule tags Antiviral protein
molecule keywords Leaf cyclotide 2
ec nomenclature
pdb deposition date 2010-02-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling