| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 93-c-100-b-114-c-108 | 100-b-125 |
Chain Sequence |
CVATRNSCKPAAAACCDPAASCYCRFFRSACYCR
|
| sequence length |
34
|
| structure length |
34
|
| publication title |
Loop-swapped chimeras of the agouti-related protein and the agouti signaling protein identify contacts required for melanocortin 1 receptor selectivity and antagonism.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Agouti-signaling protein
|
| ec nomenclature | |
| pdb deposition date | 2010-07-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
