2LB7A

Hevein-type antifungal peptide with a unique 10-cysteine motif
Cysteine knot
Loop Piercing
view details
4-c-13-b-25-c-25 4-b-19
Chain Sequence
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
sequence length 44
structure length 44
publication title Solution structure of a defense peptide from wheat with a 10-cysteine motif.
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Antimicrobial peptide 1a
source organism Triticum kiharae
ec nomenclature
pdb deposition date 2011-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2lb7A00
2LB7A
chains in the KnotProt database with same CATH superfamily
2LB7A
chains in the KnotProt database with same CATH topology
2LB7A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2LB7 A; 
#chains in the KnotProt database with same CATH topology
 2LB7 A; 
#chains in the KnotProt database with same CATH homology
 2LB7 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.