| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-13-b-25-c-25 | 4-b-19 |
Chain Sequence |
AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
|
| sequence length |
44
|
| structure length |
44
|
| publication title |
Solution structure of a defense peptide from wheat with a 10-cysteine motif.
pubmed doi rcsb |
| molecule tags |
Antimicrobial protein
|
| molecule keywords |
Antimicrobial peptide 1a
|
| source organism |
Triticum kiharae
|
| ec nomenclature | |
| pdb deposition date | 2011-03-23 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Wheat Germ Agglutinin (Isolectin 2); domain 1 | Wheat Germ Agglutinin (Isolectin 2); domain 1 |
#chains in the KnotProt database with same CATH superfamily 2LB7 A; #chains in the KnotProt database with same CATH topology 2LB7 A; #chains in the KnotProt database with same CATH homology 2LB7 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
