2LL1A

High-resolution solution structure of the orally active insecticidal spider venom peptide u1-trtx-sp1a
Cysteine knot
Loop Piercing
view details
2-c-9-b-25-c-20 19-b-30
Chain Sequence
DCGHLHDPCPNDRPGHRTCCIGLQCRYGKCLVR
sequence length 33
structure length 33
publication title High-resolution solution structure of the orally active insecticidal spider venom peptide U1-TRTX-Sp1a
rcsb
molecule tags Toxin
molecule keywords U1-TRTX-Sp1a
ec nomenclature
pdb deposition date 2011-10-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling