2LVZA

Solution structure of a eosinophil cationic protein-trisaccharide heparin mimetic complex
Cysteine knot
Loop Piercing
view details
37-c-55-b-111-c-96 23-b-83
Chain Sequence
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
sequence length 133
structure length 133
publication title Insights into the glycosaminoglycan-mediated cytotoxic mechanism of eosinophil cationic protein revealed by NMR.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Eosinophil cationic protein
source organism Homo sapiens
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling