2M50A

Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, huwentoxin-iv (-trtx-hh2a).
Cysteine knot
Loop Piercing
view details
2-c-9-b-24-c-17 16-b-31
Chain Sequence
ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCAYQI
sequence length 35
structure length 35
publication title Analysis of the Structural and Molecular Basis of Voltage-sensitive Sodium Channel Inhibition by the Spider Toxin Huwentoxin-IV ( mu-TRTX-Hh2a).
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mu-theraphotoxin-Hh2a
source organism Haplopelma schmidti
ec nomenclature
pdb deposition date 2013-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling