| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 25-c-32-b-44-c-42 | 38-b-50 |
Chain Sequence |
SGSGASKAPTSFAEYWNLLSAGGVCPKILQRCRRDSDCPGACICRGNGYCG
|
| sequence length |
51
|
| structure length |
51
|
| publication title |
In Vivo Activation of the p53 Tumor Suppressor Pathway by an Engineered Cyclotide.
pubmed doi rcsb |
| molecule tags |
Protein binding/signaling protein
|
| molecule keywords |
MCo-PMI
|
| source organism |
Synthetic construct
|
| ec nomenclature | |
| pdb deposition date | 2013-05-07 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
