2M9LA

Solution structure of protoxin-1
Cysteine knot
Loop Piercing
view details
2-c-9-b-21-c-16 15-b-28
Chain Sequence
ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS
sequence length 35
structure length 35
publication title A tarantula-venom peptide antagonizes the TRPA1 nociceptor ion channel by binding to the S1-S4 gating domain.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Beta-theraphotoxin-Tp1a
ec nomenclature
pdb deposition date 2013-06-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling