| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 8-162 | 155 | 1-7 | 222-240 | 163-221 | 7 | 19 | slipknot |
Chain Sequence |
GSAADLELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLGGGGSGGGGEFAGVLWDVPSPPPVGKAELEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNAGTIGAVSLDFSPGTSGSPIIDKKGKVVGLYGNGVVTRSGAYVSAIAQTEKSIEDNPEIE
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1m | 10-156 | 147 | 1-9 | 171-240 | 157-170 | 9 | 70 | slipknot | ||
| view details |
|
2.1m | 9-186 | 178 | 1-8 | 198-240 | 187-197 | 8 | 43 | slipknot | ||
| view details |
|
2.1m | 9-212 | 204 | 1-8 | 225-240 | 213-224 | 8 | 16 | slipknot |
| sequence length |
240
|
| structure length |
240
|
| publication title |
NMR structure of an inhibitor bound dengue NS3 protease provides new insights into the NS2B NS3 ligand interactions
rcsb |
| molecule tags |
Hydrolase/hydrolase inhibitor
|
| molecule keywords |
Serine protease subunit NS2B, Serine protease NS3
|
| source organism |
Dengue virus 2
|
| total genus |
 Genus: 36
|
| ec nomenclature |
ec
2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase. ec 2.1.1.57: Methyltransferase cap1. ec 2.7.7.48: RNA-directed RNA polymerase. ec 3.4.21.91: Flavivirin. ec 3.6.1.15: Nucleoside-triphosphate phosphatase. ec 3.6.4.13: RNA helicase. |
| pdb deposition date | 2013-06-18 |
| KnotProt deposition date | 2014-09-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
