2M9PA

Nmr structure of an inhibitor bound dengue ns3 protease
Slipknot S -31 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 8-162 155 1-7 222-240 163-221 7 19 slipknot
Chain Sequence
GSAADLELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLGGGGSGGGGEFAGVLWDVPSPPPVGKAELEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNAGTIGAVSLDFSPGTSGSPIIDKKGKVVGLYGNGVVTRSGAYVSAIAQTEKSIEDNPEIE
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 10-156 147 1-9 171-240 157-170 9 70 slipknot
view details
2.1m 9-186 178 1-8 198-240 187-197 8 43 slipknot
view details
2.1m 9-212 204 1-8 225-240 213-224 8 16 slipknot
publication title NMR structure of an inhibitor bound dengue NS3 protease provides new insights into the NS2B NS3 ligand interactions
rcsb
structure length 240
molecule tags Hydrolase/hydrolase inhibitor
source organism Dengue virus 2
sequence length 240
total genus Genus: 36
molecule keywords Serine protease subunit NS2B, Serine protease NS3
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
ec 2.1.1.57: Methyltransferase cap1.
ec 2.7.7.48: RNA-directed RNA polymerase.
ec 3.4.21.91: Flavivirin.
ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-06-18
KnotProt deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling