| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-8-b-21-c-16 | 15-b-29 |
Chain Sequence |
CIAHYGKCDGIINQCCDPWLCTPPIIGFCL
|
| sequence length |
30
|
| structure length |
30
|
| publication title |
Allotides: Proline-rich Cystine Knot alpha-Amylase Inhibitors from the Allamanda cathartica
rcsb |
| molecule tags |
Hydrolase inhibitor
|
| molecule keywords |
alpha amylase inhibitor
|
| ec nomenclature | |
| pdb deposition date | 2013-12-12 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...