| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-8-b-21-c-16 | 15-b-26 |
Chain Sequence |
CKSGGAWCGFDPHGCCGNCGCLVGFCYGTGC
|
| sequence length |
31
|
| structure length |
31
|
| publication title |
Ginsentides: Characterization, Structure and Application of a New Class of Highly Stable Cystine Knot Peptides in Ginseng
rcsb |
| molecule tags |
Unknown function
|
| molecule keywords |
Specific abundant protein 3
|
| ec nomenclature | |
| pdb deposition date | 2014-02-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
