2MPQA

Solution structure of the sodium channel toxin hd1a
Cysteine knot
Loop Piercing
view details
3-c-10-b-25-c-18 17-b-32
Chain Sequence
GACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL
sequence length 36
structure length 36
publication title Seven novel modulators of the analgesic target NaV 1.7 uncovered using a high-throughput venom-based discovery approach.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Hd1a
source organism Haplopelma doriae
ec nomenclature
pdb deposition date 2014-06-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.