2MQFA

Nmr structure of spider toxin-trtx-hhn2b
Cysteine knot
Loop Piercing
view details
3-c-10-b-23-c-18 17-b-30
Chain Sequence
AECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL
sequence length 34
structure length 34
publication title Rational Engineering Defines a Molecular Switch That Is Essential for Activity of Spider-Venom Peptides against the Analgesics Target NaV1.7
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mu-theraphotoxin-Hhn2b
source organism Haplopelma hainanum
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling