2MQUA

Spatial structure of hm-3, a membrane-active spider toxin affecting sodium channels
Cysteine knot
Loop Piercing
view details
2-c-9-b-23-c-18 17-b-34
Chain Sequence
GCIAKNKECAWFSGEWCCGALSCKYSIKRNLKICV
sequence length 35
structure length 35
publication title Structure of Membrane-Active Toxin from Crab Spider Heriaeus melloteei Suggests Parallel Evolution of Sodium Channel Gating Modifiers in Araneomorphae and Mygalomorphae.
doi rcsb
molecule tags Toxin
molecule keywords Neurotoxin Hm-3
source organism Heriaeus melloteei
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.