| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-23-c-18 | 17-b-34 |
Chain Sequence |
GCIAKNKECAWFSGEWCCGALSCKYSIKRNLKICV
|
| sequence length |
35
|
| structure length |
35
|
| publication title |
Structure of Membrane-Active Toxin from Crab Spider Heriaeus melloteei Suggests Parallel Evolution of Sodium Channel Gating Modifiers in Araneomorphae and Mygalomorphae.
doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Neurotoxin Hm-3
|
| source organism |
Heriaeus melloteei
|
| ec nomenclature | |
| pdb deposition date | 2014-06-27 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
