| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-8-b-25-c-21 | 20-b-40 |
Chain Sequence |
CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM
|
| sequence length |
41
|
| structure length |
41
|
| publication title |
omega-Tbo-IT1-New Inhibitor of Insect Calcium Channels Isolated from Spider Venom.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Omega-Tbo-IT1 toxin
|
| source organism |
Tibellus oblongus
|
| ec nomenclature | |
| pdb deposition date | 2015-01-23 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
