2MZFA

Purotoxin-2 nmr structure in water
Cysteine knot
Loop Piercing
view details
4-c-11-b-28-c-19 18-b-44
Chain Sequence
AKACTPLLHDCSHDRHSCCRGDMFKYVCDCFYPEGEDKTEVCSCQQPKSHKIAEKIIDKAKTTL
sequence length 64
structure length 64
publication title Purotoxin-2 - uncommon modular structure of P2X3 modulator.
rcsb
molecule tags Toxin
molecule keywords Purotoxin-2
source organism Geolycosa sp. a267tdls2-kzarna
ec nomenclature
pdb deposition date 2015-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling