2N1NA

Solution structure of vstx1
Cysteine knot
Loop Piercing
view details
3-c-10-b-22-c-17 16-b-29
Chain Sequence
SECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF
sequence length 35
structure length 35
publication title Molecular basis of the interaction between gating modifier spider toxins and the voltage sensor of voltage-gated ion channels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Kappa-theraphotoxin-Gr3a
source organism Grammostola rosea
ec nomenclature
pdb deposition date 2015-04-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling