2N3PA

Solution nmr structure of asteropsin g from marine sponge asteropus
Warning
  • Chain breaks within knotoid 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Cysteine knot

  Help Cysteine knot data interpretation Full screen
Loop Piercing
view details
3-c-10-b-21-c-16 15-b-30
Chain Sequence
EWCAEEGESCEVYPCCDGLICYPTFPEPICGV
sequence length 32
structure length 32
publication title Stable and non-cytotoxic cystine knot peptides from a marine sponge asteropus
rcsb
molecule tags Toxin
molecule keywords Asteropsin_G
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling