| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 16-c-22-b-47-c-47 | 16-b-37 |
Chain Sequence |
QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYKEKRNLQCICDYCEY
|
| sequence length |
54
|
| structure length |
54
|
| publication title |
NMR Structure of sweeter mutant of sweet protein Brazzein
rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Defensin-like protein
|
| source organism |
Pentadiplandra brazzeana
|
| ec nomenclature | |
| pdb deposition date | 2015-08-13 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
