| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-10-b-26-c-21 | 20-b-31 |
Chain Sequence |
RDCQEKWEYCIVPILGFVYCCPGLICGPFVCV
|
| sequence length |
32
|
| structure length |
32
|
| publication title |
Development of a mu O-Conotoxin Analogue with Improved Lipid Membrane Interactions and Potency for the Analgesic Sodium Channel NaV1.8.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
muO-conotoxin MfVIA
|
| ec nomenclature | |
| pdb deposition date | 2015-09-09 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
