| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-11-b-24-c-19 | 18-b-34 |
Chain Sequence |
SNECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT
|
| sequence length |
76
|
| structure length |
76
|
| publication title |
Single-gene recruitment underlies venom complexity in the Australian Funnel-web spider Hadronyche infensa
rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
spider toxin pi-hexatoxin-Hi1a
|
| source organism |
Hadronyche infensa
|
| ec nomenclature | |
| pdb deposition date | 2015-10-13 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
