2NAJA

Solution structure of k2 lobe of double-knot toxin
Cysteine knot
Loop Piercing
view details
2-c-9-b-21-c-16 15-b-29
Chain Sequence
NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
sequence length 33
structure length 33
publication title Structural insights into the mechanism of activation of the TRPV1 channel by a membrane-bound tarantula toxin
pubmed doi rcsb
molecule tags Toxin
molecule keywords Tau-theraphotoxin-Hs1a
ec nomenclature
pdb deposition date 2016-01-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling