| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 7-c-14-b-43-c-43 | 7-b-36 |
Chain Sequence |
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
|
| sequence length |
55
|
| structure length |
55
|
| publication title |
Calcium binding and the role of aspartic acids in the antifungal function of PAF
rcsb |
| molecule tags |
Antifungal protein
|
| molecule keywords |
Antifungal protein
|
| source organism |
Penicillium chrysogenum
|
| ec nomenclature | |
| pdb deposition date | 2016-02-04 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
