2QQDC

N47a mutant of pyruvoyl-dependent arginine decarboxylase from methanococcus jannashii
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 13-69 57 1-12 155-159 70-154 12 5 slipknot
Chain Sequence
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVALIRISSIMPPEAEIVPLPKLPMGALVPTAYGYIISDVPGETISAAISVAIPKDKSLCGLIMEYEGKCSKKEAEKTVREMAKIGFEMRGWELDRIESIAVEHTVEKLGCAFAAAALWYK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 12-70 59 1-11 154-159 71-153 11 6 slipknot
sequence length 159
structure length 159
publication title Structures of the N47A and E109Q mutant proteins of pyruvoyl-dependent arginine decarboxylase from Methanococcus jannaschii.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (Pvl
source organism Methanocaldococcus jannaschii
total genus Genus: 44
ec nomenclature ec 4.1.1.19: Arginine decarboxylase.
pdb deposition date 2007-07-26
KnotProt deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01862 PvlArgDC Pyruvoyl-dependent arginine decarboxylase (PvlArgDC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.20.10 Alpha Beta 3-Layer(bba) Sandwich Pyruvoyl-Dependent Histidine Decarboxylase; Chain B Pyruvoyl-Dependent Histidine Decarboxylase, subunit B 2qqdC00
1N2MA 2QQDC
chains in the KnotProt database with same CATH superfamily
1N2MA 2QQDC
chains in the KnotProt database with same CATH topology
1N2MA 2QQDC
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1N2M A;  2QQD C; 
#chains in the KnotProt database with same CATH topology
 1N2M A;  2QQD C; 
#chains in the KnotProt database with same CATH homology
 1N2M A;  2QQD C; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.