Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 7-110 | 104 | 1-6, 111-121 | 6 | 11 | knot |
Chain Sequence |
IQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAFEKSIIVQTSRMFPVSLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1m | 10-113 | 104 | 114-121 | 1-2 | 3-9 | 2 | 7 | slipknot | ||
view details |
![]() |
2.1m | 11-115 | 105 | 1-9, 121-121 | 10-10, 116-120 | 9 | 1 | slipknot |
sequence length |
121
|
structure length |
121
|
publication title |
Agrobacterium tumefaciens VirC2 enhances T-DNA transfer and virulence through its C-terminal ribbon-helix-helix DNA-binding fold
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
molecule keywords |
Protein virC2
|
source organism |
Agrobacterium tumefaciens
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2007-10-05 |
KnotProt deposition date | 2014-07-31 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...