| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 126-c-132-b-159-c-159 | 126-b-149 |
Chain Sequence |
MQTQSTCPEIPDKTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPV
|
| sequence length |
58
|
| structure length |
58
|
| publication title |
Solution structure of the rat P2X4 receptor head domain involved in inhibitory metal binding
rcsb |
| molecule tags |
Transport protein
|
| molecule keywords |
P2X purinoceptor 4
|
| source organism |
Rattus norvegicus
|
| ec nomenclature | |
| pdb deposition date | 2014-11-12 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
