2RUPA

Solution structure of rat p2x4 receptor head domain
Cysteine knot
Loop Piercing
view details
126-c-132-b-159-c-159 126-b-149
Chain Sequence
MQTQSTCPEIPDKTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPV
sequence length 58
structure length 58
publication title Solution structure of the rat P2X4 receptor head domain involved in inhibitory metal binding
rcsb
molecule tags Transport protein
molecule keywords P2X purinoceptor 4
source organism Rattus norvegicus
ec nomenclature
pdb deposition date 2014-11-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.