2V33B

High resolution crystal structure of domain iii of e1 fusion glycoprotein of semliki forest virus
Cysteine knot
Loop Piercing
view details
301-c-306-b-380-c-376 306-b-380
Chain Sequence
EAPTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCSASCEP
sequence length 91
structure length 91
publication title High Resolution Structure of Domain III from Class II Fusion Protein of Semliki Forest Virus
rcsb
molecule tags Viral protein
molecule keywords E1 ENVELOPE GLYCOPROTEIN
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2007-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2v33B00
2V33B
chains in the KnotProt database with same CATH superfamily
1ASOA 2V33B 2B9BA
chains in the KnotProt database with same CATH topology
2V33B
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2V33 B; 
#chains in the KnotProt database with same CATH topology
 1ASO A;  2V33 B;  2B9B A; 
#chains in the KnotProt database with same CATH homology
 2V33 B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.